SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000296525 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000296525
Domain Number 1 Region: 65-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.37e-53
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 287-328
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000575
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000296525
Sequence length 329
Comment ASB5 (Homo_sapiens) ankyrin repeat and SOCS box-containing 5
Sequence
MSVLEESRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
ITQGQGSWADRSPLHEVASQGRLLALRTLLSQGYNVNAVTIDHVTPLHEACLGGHVACAK
TLLEAGANVNAITIDGVTPLFNACSQGSASCTELLLEYGAKAQLESCLPSPTHEAASKGH
HECLDILISWCIDVDQDIPYLGTPLYVACMSQQYHCIWMLLYAGADVQKGKYWDTPLHAA
AQQSSTEIVNLLLEFGADINAKNAELLRPIDVATSNHAVERVLLQHEATPSSLCQLCRLC
IRNCIGRPRLHLIYQLQLPTLLQNFLQYR
Download sequence
Identical sequences G5BXZ9
XP_004853015.1.39548 HGL_H00000296525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]