SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000297265 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000297265
Domain Number - Region: 114-194
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0256
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000297265
Sequence length 229
Comment CHMP4C (Homo_sapiens) chromatin modifying protein 4C
Sequence
MSKLGKFFKGGRTSKGQAAPSAQEALVRLRETEEMLGKKQEYLESRIQRELALARKHGSQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGLAAKAMKAIH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDGFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPDRKQSAHRSRTASSRRTEEEDDFNELAAWASY
Download sequence
Identical sequences G5BAK1
HGL_H00000297265 XP_004842052.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]