SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000297404 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000297404
Domain Number 1 Region: 8-206
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.23e-52
Family Voltage-gated potassium channels 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000297404
Sequence length 274
Comment KCNV1 (Homo_sapiens) potassium channel, subfamily V, member 1
Sequence
MALMSAELSWLNLQLLEILEYVCISWFTGEFVVRFLCVRDRCRFLRKVPNIIDLLAILPF
YITLLVESLSGSQTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEV
GLLLLFLSVGISIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGK
IVAFMCILSGILVLALPIAIINDRFSACYFTLKLKEAAARQREALKKLTKNIATDSYISV
NLRDVYARSIMEMLRLKGRERASTRSSGGDDFWF
Download sequence
Identical sequences G5AVJ1
HGL_H00000297404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]