SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000297785-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000297785-2
Domain Number 1 Region: 13-435
Classification Level Classification E-value
Superfamily ALDH-like 6.15e-120
Family ALDH-like 0.0000000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000297785-2
Sequence length 440
Comment ALDH1A1 (Homo_sapiens) aldehyde dehydrogenase 1 family, member A1
Sequence
MSSAKAAIPASLTDLKIQYTKIFINNEWNNSVSGRKFPVINPATEEKICEVEEGDKADVD
KAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMEVINAGKVFSNTYLM
EMELSINGLRYFAGWADKIQGRTIPVDGDFFTWNFPLILLVWKIGSALSCGNTVIIKPAE
QTPLAALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKIITE
AAGKSNLKRVTLELAGKSPCIVFADADLDNTVESAHGQCRVAASRLFVEEWIYDEFVRRS
VERAKKYVLGNPITPGVNHCPQIDKEQYDKILDLIESGKKQEAKLELGRGPWGNTGYFIQ
PTVFSNVTDEMRIAKEEKHGENFMNFICEMKQWMNISKSTGNKAVMVSSALQVGTVWGEE
GFHEYTEIKTVTMKISQKNS
Download sequence
Identical sequences G5BFF0
HGL_H00000297785-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]