SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000297785-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000297785-3
Domain Number 1 Region: 2-476
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-179
Family ALDH-like 0.000000000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000297785-3
Sequence length 481
Comment ALDH1A1 (Homo_sapiens) aldehyde dehydrogenase 1 family, member A1
Sequence
QIFINNEWNNSVSGKKFSVINPATEEIICQVEEGDKADVDKAVKAARQAFQIGSPWRTMD
ASERGRLLYKLADLIERDRLLLATMEAINAGKLFSNTYLMDIEMSVKGLRYFAGWADKIQ
GRTIPVDGDFFTYTRREPIGVCGQIIPWNFPLLILVWKIGPALSCGNTVVVKPAEQTPLT
ALHVASLIKEVGFPPGVVNIVPGYGPTAGAAISSHTDIDKVAFTGSTEVGKIITEASGKS
NLKRVTLELGGKSPCIVFPDADLDSAVEYAHGALFFHQGQCCVAASRLFVEESIYDEFVQ
RSVERAKKYVLGNPLTPGVNHGPQIDKEQYDKILGLIESGKKQGAKLELGGGPWGNKGYF
IQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKTLDEVIKRANNTTYGLAAGGIFTKDLDKA
VTVSSALQAGTVWVNCYGGGGTQSPFGGYKMSGNGREMGEEGVYEYTEIKTVTMKISQKN
S
Download sequence
Identical sequences G5BLW4
HGL_H00000297785-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]