SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000298173 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000298173
Domain Number 1 Region: 336-393
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.46e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 26-68
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000018
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000298173
Sequence length 393
Comment GTF2A1 (Homo_sapiens) general transcription factor IIA, 1, 19/37kDa
Sequence
MLSTSRSSQRAARDFRLDAYHVITRDLPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELK
TLWESKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQ
QVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLL
QVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQP
QQILFTGNKTQVIPTTVAAPTAAQAQITAAGQQQPQAQPTQQQAPLVLQVDGTGDTSSEE
DEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIH
RSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences G5AJS0
HGL_H00000298173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]