SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000298480 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000298480
Domain Number 1 Region: 127-308
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-24
Family Voltage-gated potassium channels 0.003
Further Details:      
 
Weak hits

Sequence:  HGL_H00000298480
Domain Number - Region: 463-582
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00167
Family Potassium channel NAD-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000298480
Sequence length 1061
Comment KCNT1 (Homo_sapiens) potassium channel, subfamily T, member 1
Sequence
MSDLDSEVLPLPPRYRFRDLLLGDQPFPSDDRLQVEDFSLDSSLSQVQVEFYVNENTFKE
RLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDNPARGIGCWGCTKHNYTFNGSS
SEINWAPILWVERKLTLWVIQVIVATISFLETMLLIYLSYKGNIWEQIFRVSFVLEMINT
LPFIITVFWAPLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQSAMFNQVLILFCTLL
CLVFTGTCGIQHLERAGENLDLLTSFYFCIVTFSTVGYGDVTPKIWPSQLLVVIMICVAL
VVLPLQVGPGPTGSVLCGGLSQGLGAGAREPQSRHPTPDPCSGKREEGPWCELGCCGLSS
SDGCALCRQGCCASSTSSGGGGPCTFSLEPFGMRLLTFEELVYLWMERQKSGGNYSRHRA
QTEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQIPLWSQR
VIYLQGSALKDQDLMRAKMDNGEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLY
VQILKPENKFHVKFADHVVCEEECKYAMLALNCVCPATSTLITLLVHTSRGQEGQESPEQ
WQRMYGRCSGNEVYHIRMGDSKFFREYQGKSFTYAAFHGHKNRRPSIAPVLELADSSALL
PCDLLSDQSEDEAMPSEDEGLSAVEYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDK
GCKHNSYEDAKAYGFKNKLIIVSAETAGNGLYNFIVPLRAYYRPRRELNPIVLLLDNRPD
HHFLEAICCFPMVYYMEGSVDNLDSLLQCGIIYADNLVVVDKESTMSAEEDYMADAKTIV
NVQTMFRLFPSLSITTELTHPSNMRFMQFRAKDSYSLALSKLEKRERENGSNLAFMFRLP
FAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLDTTPGSGYLCAMKVSEDDLWIRTYG
RLFQKLCSSSAEIPIGIYRTECHVFSSEELSELVKNRMKHLGLPTTGYGTGHQGHSERAL
SSDAADGESSPAQPPQHQCLPRTPAPLSRTELAEQPLPFGS
Download sequence
Identical sequences G5BQR6
HGL_H00000298480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]