SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000298838 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000298838
Domain Number 1 Region: 21-300
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.46e-67
Family FCH domain 0.0081
Further Details:      
 
Domain Number 2 Region: 364-427
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-18
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000298838
Sequence length 429
Comment PACSIN3 (Homo_sapiens) protein kinase C and casein kinase substrate in neurons 3
Sequence
MAPEEDAGGEALGGSFWEAGNYRQTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLAEW
ARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSEQVRSWQRGAFHR
PVLGGFRESRAAEDSFRKAQKPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKADSAV
SQEQLRKLQERVGRCTKEAEKTKSQYEQTLAELHRYTPRYMEDMEQAFESCQAAERQRLL
FFKDMLLTLHQHLDLSSNDKFHELHRDLHQGIEAASDEEDLRWWRSTHGPGMAMNWPQFE
ARVACWEWSLDTQRTISRKERGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGGQEEEWSD
EETPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYP
ANYVECVGA
Download sequence
Identical sequences G5BPC1
HGL_H00000298838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]