SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000298910 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000298910
Domain Number 1 Region: 1879-2123
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.29e-56
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 969-1308
Classification Level Classification E-value
Superfamily L domain-like 7.48e-49
Family Internalin LRR domain 0.041
Further Details:      
 
Domain Number 3 Region: 165-608
Classification Level Classification E-value
Superfamily ARM repeat 5.5e-28
Family Armadillo repeat 0.062
Further Details:      
 
Domain Number 4 Region: 1328-1488
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.54e-25
Family G proteins 0.0019
Further Details:      
 
Domain Number 5 Region: 2186-2467
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000275
Family WD40-repeat 0.011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000298910
Domain Number - Region: 530-787
Classification Level Classification E-value
Superfamily ARM repeat 0.000575
Family Armadillo repeat 0.062
Further Details:      
 
Domain Number - Region: 68-197
Classification Level Classification E-value
Superfamily ARM repeat 0.00556
Family Armadillo repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000298910
Sequence length 2518
Comment LRRK2 (Homo_sapiens) leucine-rich repeat kinase 2
Sequence
XCQGSQDEETLKKLIVRLNNVQEGKQIDTLVQILEDMLVFTYSDHAAKLFEGKNFHVPLL
IVLDSYIRVASVQQVGWSLLCKLIEVCPGTLQTLMGPQDIGNDWEVLGVHQLILKMLTVH
HSNVNLSTVGLKALDLLLNSGKITLLILDEESDIFLLIFDAMSTFSSNDEVQKLGCKALH
VLFERVSEEQLTEFVENKDYMILLSALNSFKDEEEIVLHVLHCLHSLAIPCSNVEVLMSG
NVRCYNIVVEAMKAFPVSEKIQEVSCCLLHRLTLGNFFNILVLNEVHAFVVKAVQQYPEN
AVLQISALSCLALLTETIFLNQDLEVKDENQESEEEEEEEEDKLFWLEACYRALTWHRKN
KHVQEAACWALNNLLMYQSSLHQKIGDEDGQFPAHREVMLAMLMHSSSQEVLRASAAALS
TLLEQNVNFRKILLSKGIYLNVLELMQRHIHSPEVAESGCQMLNHLFEGSNTSLDTMAAL
IPKIITVMKSHETSLSVQLEALRAILHFIVPGMPEESRDESQCKLDMVKKQCLKNNIHKL
VLAALNRFIGNPGIQKCGLKVISSIAHFPEALEMLSLEGAIDSVFHTLQMYPDDQEIQCL
GLSLIGCLITEKNLCIGAGHLVAKILVSSLQRFKDVAEVQIKGFQTILAILELSVSFSKL
LVHHSFDSVIFHQLSSGNMEQKDQQFLSLCCKCFAKLAVDEELKNVMLGRACDQNNSIMV
ECLLLLGADANRAKETTALICQVCERESSPKLVELLLNSGSHEQDVRKALTISIQKGDSQ
IISLLLRRLALDLANNSVCLGGFCIGKIEPSWLGPLFPDKTSSLRKQTNTGSMLARMVLR
YQMKSAVEEGAASGGGGNFSENVLDKFDDWTFIPDSSMDSVFGQSDDLDSEGSEGSFFAK
KKSNSVNVGEFYRDPVLQRCSPNLQRHSSSLGPSFDHEDFLRRKRKLLSSDDSLRSSKLQ
PYMRHSDSVSSIASERDYITSLDLSANELRDIDALSQKCCISGHLEHIEKLELHQNALTG
FPQQLCETLKCLTHLDLHSNKFTSFPSYLLKMNCISNLDASRNNIGPSIVLDASVRCPTL
KQLNLSYNQLSSVPENLPDVVEKLEQLILEGNKISGIYSPLSLKELKILNLSKNHISSLP
ENFLEACPRVESFSARMNSLAAMPFLPSSITSLKLSQNKFTRIPDAILNLPHLRSLDMSS
NDIEYLPSPANWKSLNLRELLFSYNQISILDLSEKACTWSRVEKLHLSHNKLKEIPPEIG
CLENLTSLDVSYNMELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQR
LKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDIGMQGATVGIDVRDWPIQIRGKRK
KDLILNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSS
PVILVGTHLDVSDEKQRKACISKITKELLNKRGFPSIRDYHFVNATEESDALAKLRKTII
NESLNFKIRDQPVVGQLIPDCYVELEKIILTERKNVPIEFPVIDQKRLLQLVKENRLQLD
ENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTIKVEGCPKYPKGI
ISRRDVEKFLSKKRRFPKNYMTQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHC
ENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPE
AYCLVGSEVLDNQQESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGE
TLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLP
RNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLC
HLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQHLTRTLQHRIALHVADGLRYLHSAM
IIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVI
YNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELAIQGKLPDPVREYGCAPWPKVEK
LIKKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIAECMVSTNPNSKNANIWL
GCGHTDKGQLSCLDLNTEGHTLEEVTDSRILCLAVVNLPAEKESWVVSGTQSGSLLVINT
DDGTKRHTLEKMTDSVTCLYCNSFSKQSKQNNFLLVGTADGNLAIFEDKTVKCKGAAPLK
TLNIGDVSTPLMCLSESMNASERNITWGGCGTKIFSFSNDFTIQKLIETRTNQLFSYAAF
SDSNIIAVVVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHLLKEITVKVNRESKHKMS
YSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRIIRIIYNFCDSVRVMMTAQLGNLKNV
MLVLGYDQKSTEGLQHQKEIQSCLSVWDINLPHEVQNLEKHIEMRQELAEKMRRTSVE
Download sequence
Identical sequences HGL_H00000298910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]