SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000299001-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000299001-2
Domain Number 1 Region: 209-398
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.1e-41
Family PIWI domain 0.012
Further Details:      
 
Domain Number 2 Region: 43-167
Classification Level Classification E-value
Superfamily PAZ domain 3.84e-18
Family PAZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000299001-2
Sequence length 398
Comment PIWIL4 (Homo_sapiens) piwi-like 4 (Drosophila)
Sequence
MAYGIWMESAVFSAFHRYFLYLGSRGFSLLKWRSSSACLLWTISGQVFNIIFKKILKKLS
VYQIGQNFHKPSEPVEIPQHKLSLWPGFALSVSHFERRLLFGADVSYKVLQNETVLEFMT
DLCCKIGLAGQATSDFQLMKAVAEETHFSSLGQQQRLARLTDDIQRNKDARFELETWGLH
FGSQMSLTGWFVPSEKILMQDHRTTTNIADCLKVFMTGALKEWYKHNHDLLAWIIAYCDR
VGDGQLKAVIEYEVPQLLSSVAESGSKTSSRLSVIVDRKKCLPLFFTEMNCTVQNALVGT
VVESEAMCPEWYDFYLITQAACRGTVSPTHYNVIYYDNGLKPDHIQRLIFKLCCLYYNWQ
GLISIPAPCQYAHKLTYLVAQTIHKEPNLELANYLFYL
Download sequence
Identical sequences G5C3T3
HGL_H00000299001-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]