SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000299157 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000299157
Domain Number 1 Region: 83-220
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000915
Family Tropomyosin 0.01
Further Details:      
 
Weak hits

Sequence:  HGL_H00000299157
Domain Number - Region: 223-326
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000299157
Sequence length 377
Comment IKBIP (Homo_sapiens) IKBKB interacting protein
Sequence
MAEVRNRKKPGPKASPSEPGKRSEGGRSPEAPGGAPAAWADPRIGLSLLSLGTCLGLAGK
FVFQQSETFAKVENQYQLLKIENNEFKGLESKISLISEKLESTESTLQEATSSMSLMTQF
EQEVSTLQRFMHDIENSEEMLTQKMQTLNEKFQNITDFWKRSLAEMNGNTEIFKSEAKHI
HSQVTVQINSAEQGIKLLTERLKDLEDSTLRNIRTVKRQEEEDLMRVEEQLGSDTKVVEK
LEEEQNALLARDEDLTNKLSNYEPKVEECKMYLPTIENAIHSVLRVSQDLVGTEKKMEEL
TMQMFNMEDDMLKAISEIMELQKTLEGIQYDNSILKMQNELDVLKGKVHDFIAYSSAKEK
ETLEEYNLENKEISDDS
Download sequence
Identical sequences G5B2K9
HGL_H00000299157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]