SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000299213 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000299213
Domain Number 1 Region: 109-203
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.71e-26
Family La domain 0.0012
Further Details:      
 
Domain Number 2 Region: 239-300
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000246
Family Canonical RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000299213
Sequence length 516
Comment LARP6 (Homo_sapiens) La ribonucleoprotein domain family, member 6
Sequence
MSHEVVTCRLLPHGSLTSLKATPFTCLTVCGQHCAWYTANTLGISTGLKPKQNSDAHIIS
TKPYKQCDGSAWLASQDGAQDGVSVRVTSLSGATTSGGENEREDLEQEWKPPDEELIRKL
VDQIEFYFSDENLEKDAFLLKHVRRNKMGYVSVKLLTSFKKVKHLTRDWRTTAYALKYSV
TLELNEDHRKVRRTTPVPLFPSENLPSKMLLVYDLHLSPKLWALSTPQKNGRVQEKVMEH
LLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM
ITESQSKENMKAVLIGMKPPKKKPSKDRSHDEEPTVSIHLNKSLNKRVEELQYMGDESSA
NSSSDPESNPTSPMAGRRHVATNKLSPSGHQNLFLSPNASPCSSPWSSPLAQRKGVSRKS
PLAEDGRLNSSTSPEIFRKCTDYSSDSSATPSGSPWVRRRRQAEMGTQEKSPGASPLLSR
KMQSADGLPVGVLRLPRGPDNTRGFHGGHERGRACV
Download sequence
Identical sequences HGL_H00000299213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]