SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000299234 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000299234
Domain Number 1 Region: 10-303
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 7.33e-90
Family Glutaminase/Asparaginase 0.000000135
Further Details:      
 
Domain Number 2 Region: 345-495
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-28
Family Ankyrin repeat 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000299234
Sequence length 506
Comment ASPG (Homo_sapiens) asparaginase homolog (S. cerevisiae)
Sequence
SCSPACPDQRVIYTVLERQPLLDSSDMTITEWVQVAQIVERHYEQYHGFVVVHGTDTMAF
AASVLSFVLENLHKPVILTGAQVPIHALWNDGRENLLGALLMAGQYIIPEVCLFFQNQLF
RGNRATKVDTQRFGAFCSPNLPPLATVGTDVTVSWELVRKVSREDQLVVHSSVEHNVGLL
RLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPTKPDLLQELRAAAERGLILVNCTHCLQ
GAVTPGYAAGLASVGAGIVSGFDMTSEAALAKLSYVLGRPGLSLDDRKQLLAKDLRGEMT
LPTVDKHQSPLQGSKLGHSVAWLLGLSGSQEADAVRDTLVPSLALAAAHAGDLEALQALV
ELGSGLCLQDPNGQTLLHAAARRGHVGAVTMLLRRGVDVSARDQDGLTPLLLAVRGRHWG
VIQLLRAAGACLSPQDLEDAGTELCRLASRADTEGLRAWCQAGADLEQPGYDGRSALRVA
EAAGNLEVVALLQSLEGAGHVSPPAP
Download sequence
Identical sequences G5AWI1
HGL_H00000299234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]