SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000300584 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000300584
Domain Number 1 Region: 686-866
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0021
Further Details:      
 
Domain Number 2 Region: 844-960
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.54e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0069
Further Details:      
 
Domain Number 3 Region: 116-199
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000258
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Weak hits

Sequence:  HGL_H00000300584
Domain Number - Region: 538-600
Classification Level Classification E-value
Superfamily Tropomyosin 0.0386
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000300584
Sequence length 1013
Comment TBC1D2B (Homo_sapiens) TBC1 domain family, member 2B
Sequence
MPGPFPGGRGQGRGVGGPGEGTRTGSALQSAGGGVGLQVPGRRSRGGGEGPWRGWDYKSQ
GAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDARRCHL
YYFKSPQDALPLGRLDIADACFCYPGADESAEPGAELPAHFQVHSAGAVAVLKAPNRQLM
TYWLQELQQKRWEYCNSLDMVKWNSRTSPTPGEFPKGLVARSNTDVIYPHPNTSAEKARN
VLAIETVPGELVGEQAANQPAPGHQNPINFYSLRQWGSELKNSMSSFRPGRGHNDSRKTV
FYTNEEWELVDPPPKDLEESVVQEERKKQIPEGSKGVSGSGFSFDFGRNPYKGKRPLKDI
IGSYKNRHSSGDPSSEGMLATGSVRLASEMQLQVQSQQEELERLKKDLTSQKELVRLLQQ
TVRSSQYDKYFTSGRFCEGVPGATLELLHQKDDQILGLSSQLERLSLEKESLQQEVRTLK
NTVGELDERLGMLMETIQAKDEVIIKLSEGEGNVSSPSLVPGSNLVAPASRDQLELDRLK
DNLQGYKAQNKFLNKEILELSALRRNAERRERDLMAKYSSLEAKLCQIESKYLILLQEMK
TPVCSEEQGPTREVIAQLLEDALQVESQEQQEQAFVKPHLVSEYDIYGFRTVPDDDEEEK
LVAKVRALDLKTLYLTENQEVSTGVKWENYFASTVNREMVCSPELKTLIRSGIPHEHRSK
VWKWCVDFHTRKFKDGAEPGYFQALLQKALEKQNPASKQIELDLLRTLPNNKHYSCPTSE
GIQKLRNVLLAFSWRNPDIGYCQGLNRLVAVALLYLEQEDAFWCLVTIVEVFMPRDYYTK
TLLGSQVDQRVFRDLMNEKLPRLHAHFEQYKVDYTLITFNWFLVVFVDSVVSDILFKIWD
SFLYEGPKVIFRFALAVFKYKEEEILKLQDSMSIFKYLRYFTRTILDARKLINISFVDLN
PFPLRQIRNRRAYHLEKVRQELTELEAIREDFLREREPGPDKGGLVSDEEEDA
Download sequence
Identical sequences HGL_H00000300584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]