SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000300738-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000300738-1
Domain Number 1 Region: 209-637,670-746
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.27e-192
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 1-208
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 6.67e-70
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000300738-1
Sequence length 787
Comment RRM1 (Homo_sapiens) ribonucleotide reductase M1
Sequence
DGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAAT
LTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGRHSPMVAKSTLDIVLA
NKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAA
IETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAG
GIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL
DIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEE
FEKLYESYEKQGRVRRVVKAQQLWYAIIESQTETGTPYMLYKDYSYNQKSNQQNLGTIKC
SNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVIVRNLNKIIDINY
YPIPEAHLSNKCHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGALEASCD
LAKEHGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLIAPMPTA
STAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIACNGS
IQSILEIPDDLKQLYKTVWEISQKTVLKMAADRGAFIDQSQSLNIHIAEPNYGKLTSMHF
YGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKASKEEEEKERNTAAMVCSLENRD
ECLMCGS
Download sequence
Identical sequences G5B9C2
HGL_H00000300738-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]