SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000300793 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000300793
Domain Number 1 Region: 68-280
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000992
Family WD40-repeat 0.035
Further Details:      
 
Domain Number 2 Region: 795-835
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000184
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 360-605
Classification Level Classification E-value
Superfamily ARM repeat 0.000000374
Family Clathrin heavy-chain linker domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000300793
Sequence length 915
Comment VPS11 (Homo_sapiens) vacuolar protein sorting 11 homolog (S. cerevisiae)
Sequence
MAAYLQWRRFVFFDKELVKEPLGNDGAAPGPTPASGSTASKFLCLPSGITVCDSGRGSLV
FGDILTGFQAYKLRVTHLYQLKQHNILASVGEDEEGINPLVKIWNLEKRDGGNPLCTRIF
PAIPGTEPTVVSCLTVHENLNFMAIGFTDGSVKLNKGDITRDRHSKTQILHKGNYPVTGL
AFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGCGLRCSALSDPSQDLQFIVAGD
ECVYLYQPDERGPCFAFEGHKLIAHWFRGYLVIVSHDRKVSPKSEFTSRDSQSSDKQILN
IYDLCNKFIAYSAVFEDVVDVLAEWGSLYVLTRDGRMLFKKNLFEMAINLAKSQHLDSDG
LAQIFMQYGDHLYSKGNHDGAVQQYIRTIGKLEPSYVIRKFLDAQRIHNLTAYLQTLHRQ
SLANADHTTLLLNCYTKLKDSSKLEEFIKTKSESEVHFDVETAIKVLRQAGYYSHALYLA
ENHAHHEWYLKIQLEDIKNYQEALRYIGKLPFEQAESNMKRYGKILMHHIPEQTTQLLKG
LCTDYRPNLEGRADKEAPDCRANSEEFIPIFANNPRELKAFLEHMSEVQPDSPQGIYDTL
LELRLQNWAHEKDPQVKEKLHAETISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQG
KLFQQIMHYHMQHEQYRQVIAVCERHGEQDPSLWEQALSYFARKEEDCKEYVAAVLKHIE
NKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQKQSQQIAQDELRVQRYREETTRIRQE
IQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRK
VMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTPSLE
AGLQRDLLMHSRRGT
Download sequence
Identical sequences G5BHN4
HGL_H00000300793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]