SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000300870 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000300870
Domain Number 1 Region: 549-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 595-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 261-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000803
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 8 Region: 512-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000206
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 299-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000186
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  HGL_H00000300870
Domain Number - Region: 210-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0682
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000300870
Sequence length 660
Comment ZNF267 (Homo_sapiens) zinc finger protein 267
Sequence
MLTFRDVAIDFSVEEWEFLEPAQQNLYRDVMIENYRNLLSLGLAVTKPYLITFLEQSKEL
WDVKSQGTAAIHPAMSSHHTEGFSSEKDMKHSFQKVINQRSGNCGFSSLHLKKDWKIGKC
EDENPFHNGHHQCMTTENNKSFTVNRNQEHVASQNISEFMPLHFSNPHQTIKCTFSCAKI
CSFDKHGKEFTYPLMHSQSPYIDIWQTHDIYNENGKAFKNNSTLHNCQDAHIEQKIYPCN
KITENFNHGSNPSKQHFSKNIYKCDTCGRVFDQCSQLTTHQSAHFQDKVYNYKDCGKAFV
DDSIFNQHQSIHTGEKSYKFKENAKSFKYHLTPAQYQLILTGEKSYSCKNSDTFNQNSTF
TKHQTINTGEKLYKCRESGKAYIEKSILTQHQRICTKEKPYKCKVCDKTFSQISPLTQHQ
RIHMGEKPYNCKECGKAFRYCTSIIQHQRIHTGEKPFKCKECGKAFIQRSALIQHQRIHT
KEKPYKCTKCDKTFNQTSHLTRHQRTHTGEKPYKCKECGKAFRYCTTITRHERIHTGEKP
YKCEECGKSFNQSSTLTQHQRIHTGEKPYKCKQCGKAFDRRSNLSNHERIHTAEKPYKCK
ECGKAFNQSSTLTKHQRIHTGEKPYKCTECDKTFNQISHLSRHQRTHTSNLRQHHQIHVR
Download sequence
Identical sequences G5BU02
HGL_H00000300870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]