SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301030 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301030
Domain Number 1 Region: 157-251,354-480
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.34e-58
Family Ankyrin repeat 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301030
Sequence length 2768
Comment ANKRD11 (Homo_sapiens) ankyrin repeat domain 11
Sequence
MPKSGCSKTPQQEDFPLSNDMVEKQTGKKDKDKVSLTKTPKLDRSDGGKEVRERTTKRKL
PFTVGANGEQKDSDTEKQGPERKRIKKEPVARKSGLLFGMGLSGIRAGYPLSERQQVALL
MQMTAEESANSPVDTTPKHPSQSTVCQKGTPNSASKTKDKVNKRNERGETRLHRAAIRGD
ARRIKELISEGADVNVKDFAGWTALHEACNRGYYDVAKQLLAAGAEVNTKGLDDDTPLHD
AANNGHYKVGISPPPTPAQSPNFRAILWLQKQGPERKRIKKEPVARKSGLLFGMGLSGIR
AGYPLSERQQVALLMQMTAEESANSPVDTTPKHPSQSTVCQKGTPNSASKTKDKVNKRNE
RGETRLHRAAIRGDARRIKELISEGADVNVKDFAGWTALHEACNRGYYDVAKQLLAAGAE
VNTKGLDDDTPLHDAANNGHYKVVKLLLRYGGNPQQSNRKGETPLKVANSPTMVNLLLGK
GTYTSSEESSTESSEEEDAPSFAPSSSVDGNNTDSEFEKGLKLKAKNPEPQKAVTPVKDE
YEFDEDDEQDRVPPVDDKHLLKKDYRKETKSNSFISIPKMEVKSYTKNNTIAPKKAAHRI
LSDTSDEEDTGLAVGAGEKLRLSAHSVLPSSKVREPSNSRQQKEKSKVKKKRKKEAKSKE
VRFGKRNDKFCSSESESESSESEEDDDDSVGSTGCLKGSPLVLKDPSLFSSLSASSTSSH
GSAVAPKHGTNHGDQHAKHWRTDNWKAISSPAWSEVSSLSDSSRTGLTSESDCPSEGSSV
ESLKPTRRKQELRKRGSLPSAPPEKRGTCHPGTDGAVPKLDKEGKVVKKHKTKHKHKNKE
KGQCSVSQELKLKSFTYEYEDSKQKSEKAILLDNDISTDNKLKVLKHDRDHFKKEEKLSK
LKSEDKEWIFKEEMLKVSKDEKLMKRAKDIGRSFREEKDRSGKTEREKAVKEKSPKEERL
RLYKEEKKKKSKDRPSKLEKKNDMKEDRACKEKEKLKKEKGYRDDAAFDEFCSKTQFLEN
EDTKFSLSDDQQERWFSDLSDSSFDFKGEDSWDSPVTDYRDIKNDSVAKLILETVKEDSK
EKKRDNRAREKRDFRDSFFRKKDRDCLDKSSEKRRDQVEKHKGVPSYLSEKDKKRRECAE
GGRDRRDGLDGSRERKEARLRPEEAHREDLKDCGCESAFRDKPDSDLPKGLEPWERPHAL
RLEKDRKEKVRVEKCKDKSLDRDKSEKSLLEKCQKDKEFDKCFKEKRDAKEKHKEAHSKD
RKASLDQGREKKEKMFPGLLSEDFSEKKDEKKGREKSWYIADIFTDESEDEKDDYMASSF
KAGEAGDAQRGDSLQDKEDGRELHLLDRHRKSSDRQHAEKPRDKEPKEKRKDRVAADSGR
DRKDKIFEKHREKKDKECAERYKDRKDRASVDSAQEKKNKQKLPEKVEKKHSTEDKAKSK
HKDKPEKEHSKERKGSRGAEAEKSLLEKLEEEALHEDREDSNDKASEVSSDSFTDRGQEP
GLSALLEVSFSEPPDDKARESCLTEKLRDRERHRHSSSSSKKSHDRERAKKEKAEKKEKA
EDYKDGGCRKDSSQYEKDFLDAEAYGVAYTVKADMEEELDKTVEIFPSEKKERNDPERES
AKKIEKELKPYGSSTISILKEKKKREKHREKWRDEKERHREKHTDGFLKHHKDEPKPAAK
DKDNPPNSFREKSRDESLKLSETKLKEKLRENTEREKADSMKISNGSDKLPLARDLGKKD
ARPREKLLGDGDLMMTSFERMLSQKDLEVEERHKRHKERMKQMEKMRHRSGDPKLKDKTK
PPEEGRKKSLDVPPKKPLGPDPPFKEKKLKDSAPTPPATAIEGKLGPGAECKDWPAAPPP
KEVLPPSPRPEQSRPTGVPTPSYEEVMHTPRTPSCSADDYPDLVFDCADSQHSMPVSATS
TSTCSPPFFDRFSVASSGVSENPGQTPTRPVSSNLYRSISVDIRRTPEEEFSVGDKLFRQ
QSVPAASSFGSPVQHLLEDKAPLPPVPSEKFPCLSPGYYSPDYGIPSGMPSPKVDSLHCP
PACTVSVTPSPEGVFSSLPAKASPPRGELFAPAVDGALTPDLGLPLDATEDQQATAAIIP
PEPSYLEPWDEGPFSTVITEEPGDAAEPPYPVSPVSYPLPAAEPDLEEVKDDGVGAISAT
TEGATPYTTPARLESFFGSCKPLPDAPLDQVPEPTCVSTVAQVEALGALESSFLDSGHGL
AALGQVEPVPWHDAFTSTEDDLDLGPFSLPELPLQPKDPPDVEMEPAGGSPAPPGEALPV
PAGVSSDGDGPVAEAEDQPAPPTEQAVPRLPAELEPSEEPKLDVVLEATVEAEAVADEQA
PEDLDSGSVPVPGPPEWHPLEGGDEVEAEAPAAAPGSVQPGAPEPEPRPAAEAPKSPRVE
EVPQRMTRNRAQMLASQSKQGTPPTEKEPAPAPTPTSTQASRTKARAPEEEDAQAQHPRK
RRFQRSSQQLQQQLHTSTRQTREVIQQTLAAIVDAIKLDDIEPYHSDRSNPYFEYLQIRK
KIEEKRKILCYITPQAPQCYAEYVTYTGSYLLDGKPLSKLHIPVIAPPPSLAEPLKELFK
QQEAVRGKLRLQHSIEREKLIVSCEQEILRVHCRAARTIANQAVPFSACTMLLDSEVYNM
PLESQGDENKSVRDRFNARQFISWLQDVDDKYDRMKGDENKSVRDRFNARQFISWLQDVD
DKYDRMKTCLLMRQQHEAAALNAVQRMEWQLKAQELDPAGHKSLCVNEVPSFYVPMVDVN
DDFVLLPA
Download sequence
Identical sequences G5API6
HGL_H00000301030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]