SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301042 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301042
Domain Number 1 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 90-151
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000196
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000691
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 286-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000112
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301042
Sequence length 424
Comment ZNF641 (Homo_sapiens) zinc finger protein 641
Sequence
MLSKQKAALGTGWESMNIQLDGTEPQVQRGSQEEGPRRTAPGPLEHLCCGLEEEPQSLQE
KAQSTPWVPAIPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFY
GEYVMQENCGIVVSLRFPIPKLDMLSQLGGGEEQWVPGPQDLEERDILRVTYIGDGSEQE
GDTPELEAEPPRMLSSVSEDIVPWNPEQNENWDSTPRNSRGMLLGPAFLQEDSFPNLLCN
TEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGRRHHLIRHQKTH
LHDKPSRCSECGKNFRCNSHLASHQRVHAESKSCKGQEIGENSGARKRQHAAPVPKCHVC
TECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRSSWDRG
TSVF
Download sequence
Identical sequences G5BEP5
HGL_H00000301042 XP_004863144.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]