SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301318-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301318-1
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 2 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 92-147
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 333-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 249-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000159
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301318-1
Sequence length 643
Comment ZFP28 (Homo_sapiens) zinc finger protein 28 homolog (mouse)
Sequence
ETVTFKDVAVDLTQEEWQQMKPVQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEE
PWVMEEEMFWRHSPEPRRRRENCALKVMVKGMNFKDVAIYFSQKEWECLHSVQKALYRDV
MLENYQNLISLRLSDTTPSVISLLEQGKEPWMVSRKEIKGCYPDWESRREIKNLSLEKNR
YEIKSLQQNTAKKFTHSNPEHTRVRGSKFHLEKQQGHQEGQFRGAIITSKEKPTSTQSTA
YRNPHRINTGEKSCEGKKSKKAFESQSHPIQHERIHKEKDSKCGECQKVFNSRSDRIKHL
KLHESRKKNENKKFSSTHDSEIIQAKSIQSGEKPYKCKECGKAFHSSSQLSQHQKMHIGE
KPYKCKECGKAFRSTAQLNLHQRIHTDEKFFECKECGKAFTRPSHLFRHQRIHTGENPHK
CKECGKAFRYDTQLNLHQIIHTGERRYECKECGKVYSCASQLSLHQRVHTGEKPHKCKEC
GKGFISDSHLIRHQSVHTGEKPYKCKECGKAFRRGSELTRHQRAHAGEKPYKCKECGMAF
TCSTELVRHQKVHTGERPHKCKECGKAFIRRSELTHHERSHSGEKPYKCKECGKAFGRGS
ELNRHQKIHTGEKPYECKECGKAFIRGSHLSQHQRIHSGHKSE
Download sequence
Identical sequences G5AMD5
HGL_H00000301318-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]