SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301318-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301318-2
Domain Number 1 Region: 797-854
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.59e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 956-1014
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 1479-1536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 1423-1480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 1367-1424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 149-206
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-22
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 7 Region: 1535-1592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 1591-1648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 741-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 10 Region: 853-905
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 1310-1368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 12 Region: 1255-1311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 13 Region: 276-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 685-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000565
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 15 Region: 463-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000158
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 16 Region: 528-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000343
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 17 Region: 385-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000394
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 18 Region: 314-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000014
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 19 Region: 1637-1689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000854
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 20 Region: 1085-1138
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000275
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301318-2
Sequence length 1722
Comment ZFP28 (Homo_sapiens) zinc finger protein 28 homolog (mouse)
Sequence
MLGLERLVKLSLVTLVLLGWAGACVPPRSLQSRVSSPPVQPLRKPGGLWANEGLMWPPGD
SVSMSLSPGLLSLQVLNDETSDCKEERPVPATTPGKPLRKRNSWNLLKCTYMVLTFLFVS
YNKGDWSKFEKVEGSEPNSQLCIPILRLAPVTFSDLAIYFSQEEWEWLSPTQKELYEEVM
LENYRNLVSVGLCLRRPNVITLLEKGKEPWIMEPPRRRWCPDLASKCEIEKLPPNQCSKS
KQSFYQRPVSIQIKIPTGKRVELLRRRAKKGLSAKKSLKCKDCGKIFSQRSSLKLHQNAH
TGERPYECSRCRKVFRQITSLILHQRIHNEKKSYGCDQCGKGFSKSITLILHRRIHSRKE
TSDNGMASSPNTSLSAHPSSHVVKKALQCRKCGRAFSRVAALLLHRRIHSRRKIHKCNTC
GKGFKKKSVLITHKRIHTREKAHKKEKALGQSIQRRNRFLENPFKCRKCGKSFHRISPLL
LHQKVHTSRKPYKCDNCNKDFQRLSTLILHEKIHKREILYRCNKCPKVFKRNSTLIQHLK
LHKRKKKLFECKECGKMFSGTANLKIHQNIHSEEKPFKCSLATSKPDVISFLEEGREPWV
EEKVTVGGLCPVLESEYYTKALSPKRDAYDVESPQWEIMESLTSYGLECASFQDDWECKS
QFDEQPGNPGRHFSEMLDSHEGMPTFNQQASLTFYQKFHTGGNPCGYNKCRKDFWQEEFL
INHQGIHTNEKPYKCKECGKAFKYGSRLVQHENIHSGKKPYECKECGKAFNSGSNFIQHQ
RVHTGEKPYECKDCAKAFSRSSQLIEHQRIHTGEKPYQCKECSKAFNRISHLKVHYRIHT
GEKPYLCKECGKTFSHRSQLIQHQTVHTGKKLYECKECGKAFNQGSTLIRHQRIHTGEKP
YECKETPYYMLNGDRECPLDQKSFDVMQHGALCPSTEERDQDTPQQLLLLSVVDDQGLVT
FGDVAVDFSQEEWEWLNATQRSLYRKVMLENYWNLASLGLCASKPDMISSLEQGPDPWMA
RRKRTGGQHPDWKAVCETKEFPPKNSAEEKLCQAAGTQRPTNYSLEYSLMGESWNYDTLF
KTQPNMVTSANVAVGFAPQLEPAQKSFCKTVLWENHGALGALGHCVSKPDLVAFLESGKE
HWVVQRELVAGLFPGQQSVHETQELFLKQSSCAEVATERTSAANLQCSTSRESWGSDCVF
ERKLADQEIQLRQKAASHNRALPKEREHMYNRSGRWFHLDNSEERLHNGILGKNFKKPSV
LIKQTGIYAGKKLFKCNECKKTFTQSSSLTVHQRIHTGEKPYKCNECGKAFSDGSSFARH
QRCHTGKKPYECVECGKAFIQNTSLIRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRI
HTGEKPYKCEVCHKSFRYGSSLTVHQRIHTGEKPYECNVCRKSFSHHASLTQHQRVHSGE
KPFQCKECGKAFRQNIHLASHLRIHTGEKPFECRQCGKSFSISSQLATHQRIHTGEKPYE
CKVCSKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYRCAQC
GKAFGDNSSRTQHQRLHTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPYECSACGKAF
SHRQSLSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVHTGERACNYKKSRKVFRQAA
HFAHHQRIHSGEPSTHPSLPSASSPVDLFPEFLWNPSSLPSS
Download sequence
Identical sequences G5CAV2
HGL_H00000301318-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]