SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301480 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301480
Domain Number 1 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.83e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 628-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 97-153
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-23
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 4 Region: 570-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-21
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 681-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 723-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 336-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.11e-16
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 476-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000111
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 11 Region: 268-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000664
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 12 Region: 3-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000824
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 
Weak hits

Sequence:  HGL_H00000301480
Domain Number - Region: 204-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0804
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301480
Sequence length 779
Comment ZNF560 (Homo_sapiens) zinc finger protein 560
Sequence
SGTFEDVAVDGPQVEKPLMNPTRRSIHSDGMVKNYQNVATVGCQTPIKLSPMACLKEELL
TGQKELLQDLEMQLQTKDSAIQQDFLTEHTSGGIQLDSVTFEDVAVDFTKEEWTSLDPTQ
RNLYKDVMLENYQNLSTVGRQLLKPSLISWLEEEVELTIVERGFFQEWEMHLKTKGPALE
KDIFWSDISNEIQQAGNDNEGELCDPKQSGKVFSEYTDLQVHVSTPNTEDSSECNQYEKD
FLPLLEKTSPEEKFSLLNQCAEPSTLALDTFHRTSTHDKSFEGSESGKAFVNQSQLQGHM
KTHSGENLSELEQCGKAFSLSTNSDGYAQMSTEKNFYECKKCGKFFTHPAYLNIHMQNHP
VEKPYKCQECGKAFTQRSSLIVHLRQHTREKSYECKECGKAFIQPSRLTEHMRCHTGEKP
FQCDHCGNAFASSSYLTTHLRTHTGEKPFECNVCGKAFTRSSYLLGHIRTHTGEKPYECK
VCGKAFSGRSWLTIHLRKHTGEKPYACTLCEKAFTSFAQLTEHTKTHTGEKPFQCKVCAR
TFRNSSCLKTHFRIHTGIKPYKCNFCGKDFTARSGLTKHVLIHNGEKPYDCKECGKAFST
SSALVEHIRIHTGEKPFECYKCGKALAYSSSLVAHLRSHTGEKPFQCNLCEKAFSRSSYL
RIHMRTHTGEKPYECTECGKTFPERSCLTKHVRTHTGERPYECKECGKDFTARSGLTIHL
RNHTGEKSYACQECGKAFTTSSGLIAHVRSHKGEKPFECDHCGKAFASSSYLNVHLKIH
Download sequence
Identical sequences G5B349
HGL_H00000301480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]