SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301744 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301744
Domain Number 1 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-21
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 155-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 367-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000111
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 233-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000244
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 336-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000391
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 6 Region: 10-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000209
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 
Weak hits

Sequence:  HGL_H00000301744
Domain Number - Region: 278-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0495
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301744
Sequence length 424
Comment ZNF597 (Homo_sapiens) zinc finger protein 597
Sequence
MASTLPTSDAQEPILFDDLAVYFSQEECVNLNPAQKSLTREATQECSNDVTLMGGESNTE
INEQLSLESLELEQLSLENYSIAAPEVHSQRSSEDGVGIPERKKSGGTSTYKKKLMSLLV
TIENHTPLVELSQCLGVRSLSEILEFPLEEAKNEYKCPECDQSFSDTSYLALHQKIHSGE
KKYKCDDCGKTFSHSANLRTHRRIHTGEKPYKCTRCGTTFRQQSHLSRHMNSHIKEKPYT
CDICGRSFMWLPGLAQHQKSHAAEKEYDCAHRDKSLAQKTNLALHENTHTPAIPQYQHTQ
CMKNFKQPSYPALPEKSHKEDSEQYNIDDENFFSFSRFKPLQCPECDLKFPCFSELVSHQ
NIHIKEKPYKCEMCAQSFALDSELACHQKSHRQEYPFKCSVCGKSFKANMHLVTHKRTHR
KKTL
Download sequence
Identical sequences G5B1H5
HGL_H00000301744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]