SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301765 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000301765
Domain Number 1 Region: 97-153
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000817
Family VPS37 C-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301765
Sequence length 291
Comment VPS37C (Homo_sapiens) vacuolar protein sorting 37 homolog C (S. cerevisiae)
Sequence
MEMLRDKSMQELEDMQSDPEAIGRLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELHRLGGSVDRAPSSLLPEKFSSSLQPAALLDLLQIEGLKIEEESEAM
AEKFLEGLVPLEQFLEGFPAMRTLSHLRRVRVEKLQDVVRRPRVPQEPRPAAQAAPSVAE
EAPPCPLPCGLLPGLPIGPVAQGALPPAPFPVGAQPLAYGAPPGPRPGVPTGYPWPTSRA
ALPRPSYPTARAAPSRPGYXXPGFPAQPPYPGGPRPPYGFPPPSGPAWPGY
Download sequence
Identical sequences HGL_H00000301765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]