SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000301904 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000301904
Domain Number - Region: 183-443
Classification Level Classification E-value
Superfamily Tropomyosin 0.00229
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000301904
Sequence length 668
Comment SCARA3 (Homo_sapiens) scavenger receptor class A, member 3
Sequence
MRLRVQPESDGTGSIAVRSAGSDGDALCVTEEELAGEDEDMPSFPGTQEAPLTVPFIVPC
ALNHHVAEGIDYCPDCTLQSPSGANTNPQQCADFGLEGLPGPHCSRCQKNLSLHTSVRIL
YLFLALLLVAVAVLASLVFRKVDSLSEDISLAQSIYNKKLVSMQENLQGLDLKALNNCSF
CHEAGQLGQEIRKLQEELEGLQKMLLAQEVQLDQTSQAHELLSTTSSQISQEMGTCAFSI
HQVNQSLGLFLAQVRGWQAMTASLDLSLKDLTQECYDVKAAMHQMNFTVGQTAEWIHGIQ
RKTDEETLTLQKMVTDWQNYTRLFSSLRTTSAKTGEMVKNIQATLGASSQRISQDSESMH
DLVLQVMGLQLQLDNISSFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIS
TIFTNINATDNHVHSMLKYLDDVRLSCTLGFHSHAEELYYLNKSVSLMLGTTDLLRERFS
LLSARLDFNVRNLSMIVEEMKAVDTQHGEILRNVTILRGAPGLPGPRGLKGDSGIKGPVG
GKGPKGDPGSLGPPGPQGPQGQPGEPGPVGERGPVGPRGFPGLKGSKGSFGTGGLRGQPG
PKGDVGPPGPEGPPGSPGPSGPQGKPGIAGKTGSPGQQGATGPKGEPGIQGPPGLPGPPG
PSGSQGPY
Download sequence
Identical sequences G5BY88
HGL_H00000301904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]