SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000302222-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000302222-1
Domain Number 1 Region: 271-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 215-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 327-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.77e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 159-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 105-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-16
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 80-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000981
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000302222-1
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000235
Family KRAB domain (Kruppel-associated box) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000302222-1
Sequence length 432
Comment ZNF25 (Homo_sapiens) zinc finger protein 25
Sequence
MLENYRHLVSIGYQVSKSNVVLKLKQGKEPWILEVEFPHHSGPKDPWDIHDLGARYQESP
AGNSRQVQELIFKIEALTGELKKLQKIHHQVETYECNQCGKSFCQKSALIVHRRTHFENK
SYDCGKCGKSFSKSEDLTVHQKIHTRDKTYECKECKKIFYHLSSLSRHLRTHAGEKPYEC
NQCEKSFYQKPHLMEHQKTHTGEKPFECTECGKFFYVKAYLMVHQKTHTGEKPFECKECR
KSFSQKSHLTVHQRTHTGEKPYKCKECGKLFSRNSHLKTHQRTHTGEKPYECKECGKCFY
QKSALTVHQRTHTGEKPFECNKCGKHFFYKSDLTKHHRKHTGEKPYECTECGKSFSVNSV
LRLHQRTHTGEKPYECKECGKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAH
QKTHRRKEKGDK
Download sequence
Identical sequences G5BD22
HGL_H00000302222-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]