SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000302913 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000302913
Domain Number 1 Region: 660-722
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 492-552
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.00097
Further Details:      
 
Domain Number 3 Region: 564-638
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 730-787
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-19
Family SH3-domain 0.00074
Further Details:      
 
Domain Number 5 Region: 397-478
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000984
Family SH3-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000302913
Sequence length 789
Comment SH3D19 (Homo_sapiens) SH3 domain containing 19
Sequence
MNIMNTEQSQNNIVSRIKAFEGQTNAETSGLTKKPEITPRTLPPKPAVSSGKPSVAPKPA
ANRASGEWDSTENRLKVTPREGFTPYSSLKEAGSTPVTKPELPKKPTPGLIRSGNHEISG
GGPVVESPGVGRKVPTPAPRPLLPKKSAYSENPPCPSAPPKPVPVPPRLSVASQAKAFRS
LGEGPPASPPVPALQSKPLADIDLISFDDDVLPSSSGNLAEEFVGSEVVLDPFQLPTKTE
PTKERAIQPPTTRKPTVIRIPAKPGKCLPEDPQSPPPLPAEKPIGNTYNVVSGKLSNVDR
TKNVEPDHTGETGSSGRGPPRLPPRPVNGKVIVIRRPPPKGAPERPPPPKLSATRTSSKM
HFNRSSSDMDLQKKQSHLASGLSKAKSQVFKSQDPVLPPRPKPGHPLYRKYMLPVPHGIA
SEDILSQNPGELSCKRGDVLVMLKQAENNYLECQKGEGTGRVHVSQMKIITPLDEHLRRR
ANDSSHAQKPVDSNTPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGKCRNQTG
VFPANYVKVIVDIPEGGSGKRESVSSHCVNKDPRCIARFEYIGDQKDELSFSEGEIIILK
EYVDEEWARGELGDRTGIFPLNFVELAEDHPRSGPEVLSTKVPLKTKKEDSGSDSQDNSL
SGEWCKALHSFTAETSDDLSFKRGDRILILEQLDSNWYRGRLRDKEGTFPAVFVQPCPAE
AKSMSAVGLKGRKAKALYDFHGENEEELSFKAGDVISELESVDDDWMSGELMGKSGIFPK
NYIQFLQVS
Download sequence
Identical sequences G5C1K4
HGL_H00000302913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]