SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000303015 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000303015
Domain Number 1 Region: 258-325
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000011
Family Splicing factor U2AF subunits 0.03
Further Details:      
 
Weak hits

Sequence:  HGL_H00000303015
Domain Number - Region: 189-214
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000406
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 324-352
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000824
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000303015
Sequence length 511
Comment ZRSR2 (Homo_sapiens) zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
Sequence
MGAEPTERATAAAPTVNVFEVCSSLTPASVGSGSHKKYRAALKKEKRKKRRQELARLRDS
EASQKEEEEDTLIEEQQLEEKQLESERQKLHEEWLLREQKAQEEFRIKKEREEAARKRQE
EQERKLKAEWEEQQRKEKEEEEQKLQEKREREEAVQKLLNQAENEQLENGTNWQNPEPPT
DLRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSSTLLIRSMFTTFGMEQCRRDDYD
PDASLEYSDEETYQQFLDFYHDVVPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEEC
HAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFW
EANRDLYLSPDRTGSSFGKNLDRRERASYHDDYYSRPRRRRSPGPDHSKRNGESERKRRS
SHRGKKSHKHARSRERHSSRSRGRKRNRSRDRGSQSQIRRGRRSRSRSRSRSPSRSRSRT
RSRSRSRSRSRSRGGRRSDSRDRTIQNPKSK
Download sequence
Identical sequences G5ARH9
HGL_H00000303015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]