SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000303058 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000303058
Domain Number 1 Region: 10-141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000154
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Weak hits

Sequence:  HGL_H00000303058
Domain Number - Region: 515-563
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000483
Family PLC-like (P variant) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000303058
Sequence length 987
Comment CEP120 (Homo_sapiens) centrosomal protein 120kDa
Sequence
MVSKSDQLLVVVSILEGRHFPKRPKHMLIVEAKFDGEQLATDPVDHTNQPEFATELAWEI
DRKALHQHRLQRTPIKLQCFALDPVSSAKETVGYIVLDLRTAQETKQAPKWHQLLSNKYT
KFKSEIQISITLETDTKAPVDSFKAKGAPPRDGKVPASLPGLDPKDLVAVLNEEGGYHQI
GPAEYCTDAFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLIN
PNFEPERASVRIRSSVEILRVYLALQPKLQIHLCCGDQSLGSTEIPLHGLLKRGSTEINQ
HPVTVEGAFILDPPNRAKQKLAPVPLELAPTVGVSVALQREGINCQASIELKTQNGHEPE
LSKKRVLSPVKEKTLTGPKSPSISPAAPPNQTPPAKDDATESEVESLQYDKDLKTHVKGT
SSSVPASLAQPVAASKASETASAQKIAVPATSHHFCFSIDLRSIHGLELSFPVNCILRYS
YPFFGSAAPIMTNPPVEVRKNMEVFLPQSYCAFDFATLPHQLQDTFLRIPLLVELWHKDK
MSKDLLLGISRIQLSNILSSEKTRFLGSNGEQCWRQTYSESVPVIAAQGSNNRIVDLSYT
VTLEDYGLVKMREIFVSDSSQGLPAVQQKPSSLPPAPCPSEIQTEPRETLEYKAALELEM
WKEMQEDIFENQLKQKELAHMQALAEEWKKRDRERESLVKKKVAEYNILEGKLQKTLIDL
EKREQQLASTESELQREKKELQSEREQNLKELQDSVRRVREDCVHQVELERLKIRQLEED
KHRLQKQLLDAENKNKTLEKEFQQFKDQQSNKPEIRLQSEINLLTLEKVELERKLESATK
SKLHYKQQWGRALKELARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKDTVKTEQQE
LLDIRNELNRLRQQEQKQYQDSREIASGKMDGLRGSALEEGLDDYLTRLIEERDTLMRTG
VYNHEDQIISELNRQIREVLAKNNASN
Download sequence
Identical sequences G5C983
HGL_H00000303058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]