SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000303518-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000303518-3
Domain Number 1 Region: 39-124
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-23
Family Ankyrin repeat 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000303518-3
Sequence length 144
Comment ANKRD49 (Homo_sapiens) ankyrin repeat domain 49
Sequence
MSELSDEASEPELLNSSLSMWHRLGTQVSREELDVPLDLHTAASIGQYEVVKECVQWREL
DLNKKNGGGWTPLMYASYIGHDTIVHLLLEAGVSVNVPTPEGQTPLMLASSCGNESIAYF
LLQVSYEGAKAQQPKGLPGCPDRT
Download sequence
Identical sequences G5BXS7
HGL_H00000303518-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]