SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000303540 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000303540
Domain Number 1 Region: 1551-1742,1776-1801
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-37
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 1216-1371,1410-1489
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-35
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 767-914,948-995
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 128-271,360-429
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000303540
Domain Number - Region: 1810-1855
Classification Level Classification E-value
Superfamily EF-hand 0.012
Family Calmodulin-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000303540
Sequence length 2020
Comment SCN1A (Homo_sapiens) sodium channel, voltage-gated, type I, alpha subunit
Sequence
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKI
AIKILPTLFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLE
DFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALI
QSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCIQWPATNASLEEHSIEKNITVDYN
GTLVNETVYEFDWKTYIQDSRYHYFLEGFLDALLCGNSSDAGQCPEGYICVKAGRNPNYG
YTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAV
VAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQETAQQAAATTVSEHSREPSAAGRLSD
SSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFHKSESEDSIRRKGFRFSIEGN
RLTYEKRYSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDVGSENDFADDEHSTFEDN
ESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVPT
SPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILT
NTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHIVNLVVMDPFVDLAITICIVLN
TLFMAMEHYPMTEHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVT
LSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIV
FIFAVVGMQLFGKSYKDCVCKIASDCKLPRWHMHDFFHSFLIVFRVLCGEWIETMWDCME
VAGQAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHK
GIAYVKRKIYEFIQQAFVRKKKILDEIKPLDDLNNKKDSCMSNHTGEIGKDLDYLRDING
TTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEES
KEKLNESSSSSEGSTVDIGAPAEEQPVVEPEETLEPEACFTEGCVQRFKCCQISVEEGRG
KQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTY
IFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRAL
RPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTT
GDTFEISEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYAA
VDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKIILTSCDFS
FLYFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMI
LICLNMVTMMVETDDQSDYVTSVLSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDF
VVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPA
LFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGL
LAPILNSGPPDCDPNKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENF
SVATEESAEPLSEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQL
IAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTT
LKRKQEEVSAVIIQRAYRRHLLKRTVKQASFAYNKNKLKGGANLLVKEDMIIDRINENSI
TEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK
Download sequence
Identical sequences HGL_H00000303540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]