SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000303570 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000303570
Domain Number 1 Region: 30-134
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-28
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 317-363
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000000262
Family MYND zinc finger 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000303570
Sequence length 441
Comment ANKMY2 (Homo_sapiens) ankyrin repeat and MYND domain containing 2
Sequence
MVHIKKGELAPEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLD
MCKLLLRHGADVNCHQHEHGYTALMFAALSGNKDITWAMLEAGAETDVVNSVGRTAAQMA
AFVGQHDCVTIINNFFPRERLDYYTKPQGLDKDPKLPLKLAGPLHKIITTTNLHPVKIVL
LVNENPLLAEEAALNKCYKVMDLICEKCMKQRDMNEVLALKMHYISCIFQKCINFLKDGE
NKLDALIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAPVEIGSDPTA
FSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFAHKKICKNL
KDVYEKQQLEAAKEKTQEENDVKSDVNSNCANEEQPEAEMRVSQEDSSPKDAVEGEKESP
GSEATLESGQDAPAGPQVSEE
Download sequence
Identical sequences A0A0P6JB52
HGL_H00000303570 XP_004839655.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]