SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000304292-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000304292-1
Domain Number 1 Region: 64-279
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.73e-54
Family Ankyrin repeat 0.0000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000304292-1
Sequence length 410
Comment ANKRD27 (Homo_sapiens) ankyrin repeat domain 27 (VPS9 domain)
Sequence
MVTGKPLPLDQEQWDDGSEAPTSGAGTMGLSTVVWWSGVLCVFVLWNQVPACLQRGDSAS
SGPCIWRGPNVNCTDSSGYTALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAW
KGDVEIVKILIHQGPSHSRVNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKL
ETPLDLAALYGRLRVVKMIISAHPNLMSCNTRKHTPLHLAARNGHKAVVQTEKGSALHEA
ALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYLDGVGRPTV
LEEHVQEDTTEETHISSPVESPHKTKSEAVTGELSKLLDEIKLCQEKDYSFEDLCHTISD
HYLDNLSKISEEELGKNGSQSVVSKGGNEDSVFVFADSMCTALRYVGFGT
Download sequence
Identical sequences G5BBH9
HGL_H00000304292-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]