SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000304350 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000304350
Domain Number 1 Region: 1760-2006
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.13e-265
Family Prp8 beta-finger domain-like 0.000000000253
Further Details:      
 
Domain Number 2 Region: 997-1253
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.61e-90
Family Prp8 beta-finger domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 2068-2239,2298-2314
Classification Level Classification E-value
Superfamily JAB1/MPN domain 1.54e-75
Family JAB1/MPN domain 0.0000174
Further Details:      
 
Domain Number 4 Region: 2073-2094,2121-2243,2301-2332
Classification Level Classification E-value
Superfamily CATH 7.01e-70
Family CATH 0.000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000304350
Sequence length 2335
Comment PRPF8 (Homo_sapiens) PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae)
Sequence
MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKED
MPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLY
HITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYAD
NILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDIN
KIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPIS
HRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRR
ALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRF
GNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMR
QIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQF
EGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLT
RLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLI
LALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMD
LYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYK
DMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATE
AAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARM
RLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIV
NKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPK
ELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFI
DSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEG
LFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGI
FMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSY
KMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPAL
YVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTT
KPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQ
IIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVE
VQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLT
ATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKET
GYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTP
GSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWN
YNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA
Download sequence
Identical sequences A0A091D5H0 A0A0D9RN81 A0A1S2ZJW0 A0A1U7V040 A0A2K5EA19 A0A2K5KCJ3 A0A2K5N0C7 A0A2K5RJ55 A0A2K5X038 A0A2K5ZI51 A0A2K6CLY1 A0A2K6KUA1 A0A2K6QIC0 A0A2K6U3V7 A7Z025 D2H8C5 E2R4X9 F1RHH8 F6RNK0 F7H9Y0 G1SCK0 G3QRZ4 G3TF66 G5BCV3 G7NHM1 H0VGR9 H2NS56 I3M5L4 K7DMH6 L8IZM5 L8Y837 M3W5M8 M3YP72 Q6P2Q9
ENSCAFP00000028357 ENSPPYP00000008763 ENSOCUP00000000075 ENSPPYP00000008763 ENSLAFP00000012947 ENSBTAP00000043577 ENSMPUP00000013129 ENSP00000304350 ENSP00000460348 ENSCJAP00000003611 10141.ENSCPOP00000009323 9600.ENSPPYP00000008763 9606.ENSP00000304350 9796.ENSECAP00000018808 9913.ENSBTAP00000043577 9986.ENSOCUP00000000075 ENSAMEP00000008409 ENSP00000304350 ENSECAP00000018808 NP_001099108.1.59421 NP_001099108.1.76553 NP_006436.3.87134 NP_006436.3.92137 XP_001504382.1.31192 XP_002718931.1.1745 XP_002826856.1.23681 XP_002918084.1.58354 XP_003416859.1.64505 XP_003469727.1.53824 XP_003799143.1.62490 XP_003816897.1.60992 XP_003996468.1.62641 XP_004012594.1.66739 XP_004267111.1.21590 XP_004376215.1.4749 XP_004404167.1.74151 XP_004433368.1.5094 XP_004605037.1.94378 XP_004635402.1.9945 XP_004706939.1.18182 XP_004746926.1.14098 XP_004857198.1.39548 XP_005003606.1.53824 XP_005220137.1.76553 XP_005327961.1.77405 XP_005402669.1.28644 XP_005582503.1.63531 XP_005693370.1.57651 XP_005888302.1.15283 XP_005888303.1.15283 XP_005975817.1.78601 XP_005975818.1.78601 XP_006079827.1.26621 XP_006079828.1.26621 XP_006167611.1.99106 XP_006167612.1.99106 XP_006185051.1.101512 XP_006863292.1.41390 XP_006925127.1.64745 XP_006925128.1.64745 XP_007076177.1.5354 XP_007123604.1.24612 XP_007183861.1.59432 XP_007454276.1.90284 XP_007454277.1.90284 XP_007520468.1.11023 XP_008007977.1.81039 XP_008071561.1.4292 XP_008535941.1.77740 XP_008563928.1.73410 XP_008994624.1.60252 XP_010338268.1.74449 XP_010371814.1.97406 XP_010594787.1.64505 XP_010640458.1.5607 XP_010859639.1.44457 XP_010956502.1.22495 XP_011358180.1.92234 XP_011358181.1.92234 XP_011722611.1.29376 XP_011811352.1.43180 XP_011842664.1.47321 XP_011912193.1.92194 XP_012006480.1.54773 XP_012303768.1.9421 XP_012303769.1.9421 XP_012419118.1.74151 XP_012581777.1.23501 XP_014682443.1.49734 XP_014936858.1.86478 XP_014973672.1.72884 XP_015356503.1.40921 XP_015994417.1.101085 XP_016786627.1.37143 XP_017397148.1.71028 XP_017721936.1.44346 XP_018868867.1.27298 XP_018868868.1.27298 XP_019285153.1.44245 XP_019505998.1.44202 XP_019611052.1.88060 XP_019782482.1.83887 XP_019836304.1.53367 XP_020765473.1.74333 XP_020765474.1.74333 XP_020923227.1.46622 XP_020923228.1.46622 XP_021560175.1.83697 XP_021560176.1.83697 XP_021583834.1.77405 XP_854384.1.84170 3jcr_A 5mqf_A 5o9z_A 5xjc_A 5yzg_A 5z56_A 5z57_A 5z58_A 6ff4_A ENSMPUP00000013129 gi|91208426|ref|NP_006436.3| ENSCPOP00000009323 HR3489 ENSLAFP00000012947 ENSAMEP00000008409 ENSBTAP00000043577 HGL_H00000304350 ENSCPOP00000009323 ENSCAFP00000028357 ENSOCUP00000000075 ENSP00000304350 ENSP00000460348 ENSP00000479194 ENSCJAP00000003619 ENSECAP00000018808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]