SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000304586 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000304586
Domain Number 1 Region: 39-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.5e-52
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 426-490
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000139
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000304586
Sequence length 666
Comment ANKS3 (Homo_sapiens) ankyrin repeat and sterile alpha motif domain containing 3
Sequence
MSELSDEASEPELLNSSLSMWHGLGTQVSREELDVPLDLHTAASIGQYEVVKECVQRREL
DLNKKNGGGWTPLMYASYIGHDTIVHLLLEAGVSVNVPTPEGQTPLMLASSCGNESIAYF
LLQQGAELEMKDIQGWTALFHCTSAGHQQMVKFLLDSGANANVREPVYGFTPLMEAAAAG
HEIIVQYFLNHGVKVDTRDHSGATARMLAKQYGHMKIVAMIDTHSPTLPRNLYRSPEKYE
DLSSSDESYPAAQRQRPCRKKGLSIHEGPRALARITAIGLGGQTPQPHYEQVPPRDYVTF
TSSDENPLEGEGLCYRDVTSPINEQDVESSSSSSREEPAFCASFGAVWSSSSEGLAKAQG
LSSEASLESNEDSDHARKSSVRKQTKSYMKTKSRHSNNDTQWPPSTTTSGTACSPGSVLH
TELSPYSGPQDLATLLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITLFGPKRKM
TSAIARWHSGARPPSDALELAYADRLEAEMQELAIQLHKATWSLPVQRCEEVEAMRGQVS
QEQELRAVVESCLLEQDGARKDVHTQLQETWALAQDAALILEQLRACQIELSTRMRQDQS
PSTAALSPALLPEDSKSWHAALQAMSLLELSVVLEDQVREMGQALCSVTQSLEKLQVLNG
KKWREP
Download sequence
Identical sequences G5C0K3
HGL_H00000304586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]