SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000304592 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000304592
Domain Number 1 Region: 2-355,385-404
Classification Level Classification E-value
Superfamily Thiolase-like 6.86e-73
Family Thiolase-related 0.0022
Further Details:      
 
Domain Number 2 Region: 2167-2410
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.4e-56
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00000000318
Further Details:      
 
Domain Number 3 Region: 492-617,680-778
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.91e-42
Family FabD-like 0.0035
Further Details:      
 
Domain Number 4 Region: 1582-1745
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.1e-39
Family Alcohol dehydrogenase-like, C-terminal domain 0.00013
Further Details:      
 
Domain Number 5 Region: 1825-2010
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.54e-36
Family Tyrosine-dependent oxidoreductases 0.00014
Further Details:      
 
Domain Number 6 Region: 1500-1616
Classification Level Classification E-value
Superfamily GroES-like 7.76e-16
Family Alcohol dehydrogenase-like, N-terminal domain 0.003
Further Details:      
 
Domain Number 7 Region: 2069-2131
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000419
Family Acyl-carrier protein (ACP) 0.00024
Further Details:      
 
Domain Number 8 Region: 617-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000536
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0063
Further Details:      
 
Domain Number 9 Region: 1218-1294
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000199
Family tRNA(1-methyladenosine) methyltransferase-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000304592
Sequence length 2420
Comment FASN (Homo_sapiens) fatty acid synthase
Sequence
MEEVVIAGMSGKLPESDNLDEFWANLVGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSKF
DASFFGVHPKQAHTMDPQIRLLLEVTYEAIVDAGINPALLRGTNTGVWVGVSGSEASEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLMALQNAYEAIRSGQC
PAAIVGGINVLLKPNTSVQFMKLGMLSPEGMCKSFDETGSGYCRSEAVVAVLLTKKSLAR
RVYATILNAGTNTDGSKEQGVTFPSGEAQEQLIRSLYLPAGLAPESLEYIETHGTGTKVG
DPQELNSITRALCASRQDPLLIGSTKSNMGHPEPASGLAALAKVLLCLEHGLWAPNLHFH
TPNSEIPALSDGRLQVVDRPLPVHGGIVSINSFGFGGSNVHVILQPHTKQPSPPAPHAAL
PRLLRVSGRTLEAAQSLLDQGCQHSQDLTFVSMLNDIMATSLSTMPFRGYAVLGVEGGAQ
EVQQVPSSKRPLWFICSGMGTQWYGMGVSLMHLGGFRDSILRSDEALKPVGLKVSDLLLS
TKKNTFDDIVHAFVSLTAIQIALLDLLTSMGLRPDGIIGHSLGEVACAYADGCVSQEEAV
LAAYWRGQCVKEASLPSGTMAAVGLSWEECKQRCPSGIVPACHNSEDTVTISGPQAAVSK
FVEQLKQEGVFAKEVQTGGIAFHSYFMEAIAPALLQALKKVIKEPRPRSARWLSTSIPEA
QWQGGLAHTFSAEYNVNNLVSPVLFQEALWHIPEHAVVVEIAPHALLQAVLKRGLKSSCT
IVPLMKRDHKNNLEFFLTNIGKLHLAGIDTNPDALFPPVEFPAPRGTPLISPHIKWDHSQ
TWDVPTAEDFPNGSGSSSATVYNIDTTPESPDHYLVDHCIDGRVLFPATGYLVLVWRTLA
RSLGLPLEQTPVVFEGVTLHQATILPNTGTVALEVRLLEAACTFEVSHNGNLIVSGKVYQ
WEDPDRKLFDHPEGLGPMEPVPTSCLSPADVYKELRLRGYNYGPHFQGIFEASLRGERGK
LLWRDNWVTFMDTMLQAAILGKSQRILSLPTRVTDMRIDPAVHLQKVHMLQDSTQVVDFV
VSSALSRIVAGGVHILQLHTTSAPRRQQEHTMPILERFCFTPHVEAGCLSESAALQEELQ
LCRGLARTLQAKAAQQGLKMVVPELDGARAPQEPPQQGLPRLLAAACRLQLNGNLQQALA
QERALLPEDPLLSGLLNSPVFKACLDTALENLPSPKMKVVEVLAGDGHLYSRVSALLNTH
PMLQLDYTATDRHPQALEAAQDKLKQHDVAQGQWDPADPVPSSLGAADLLLPSGRAAFCC
CTLCSEGTPSGRPVTDMRIAPAVHLQKVHMLQDSTQAQPGALRETDPSLVPQNILAEVSP
RPVWLTALGCPTSGVVGMVNCLRKEPGGHRIRCILLSNLSSTSRVPKMDPGSAELQKVLE
KDLVMNVYRDGAWGAFRHFLLGQDKPEEQTTHAFVNVLTRGDLSSIRWVCSPLKYAQPTS
PETQLCTVYYASLNFRDIMLATGKLSADAIPGKSLNRDCLLGMEFSGRDALGRRVMGLVP
SEGLATSVLVPSAFLWDVPSSWTLEEAGSVPVVYSTAYYALVVRGRLRHGESVLIHSGSG
GVGQAAIAVALSLGCRIFTTVGSAEKRAYLQSRFPQLDETSFANSRDTSFEQHVMLHTGG
KGVDVVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDA
LMEEDNPQWREVFGLLQAGIRDGVVQPLKCTVFPRAKVEDAFRYMAQGKHIGKVLVQVQE
EERESGLQGAQPAPVAAISKTFCPPHKTYVIAGGLGGFGLELAQWLLQRGARKLVLTSRS
GIRTGYQAKQVSEWRSRGVQVLVSTRDASSLEGARALLSEAAQLGPVGGVFNLAVVLRDA
MLEGQTPEQFQDVSRPKYSGTLNLDRVTREACPQLDHFVAFSSVSCGRGNMGQSSYGFAN
SAMERICEQRRHDGLPGLAVQWGAIGDVGILLDVMGGDDIVVGGTVPQRIASCLEVLDLF
LQQPHAVLSSFVLAEKAAALRDSKGQLDLMQAVAHILGIRDLAGMNLDISLADLGLDSLM
SVEVRQTLEREYDLVLSMREVRQLTLRKLQELSSRPSPDRELASPKAKDGSQVRPQAQLN
LSTLLVNPEGPTLTRLNLVQNTERPLFLVHPIEGSTTVFQNLAAKLSVPTYGLQCTQAAP
LDSIQSLAAYYIDCIKQVQPEGPYRLAGYSYGACVAFEMCSQLQAQQGPAPAHHSLFLFD
GSHTYVLAYTQVMEALLPLRSLEERVAAAVDLITQSHQGLGRRELSFAALSFYHKLRAIE
QYTPKAKYHGNVTLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLE
SIINIIHSSLAEPRVSVREG
Download sequence
Identical sequences G5BJ97
HGL_H00000304592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]