SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000304899 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000304899
Domain Number 1 Region: 5-709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.36e-246
Family Motor proteins 0.0000000000369
Further Details:      
 
Domain Number 2 Region: 1008-1071
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-21
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000304899
Sequence length 1071
Comment MYO1F (Homo_sapiens) myosin IF
Sequence
MGSKERFHWQSHNVKQSGVDDMVLLPQITEDAIVSNLRKRFMDDYIFTYIGSVLISVNPF
KQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAA
KYIMGYISKVSGGGEKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGG
EPDGGKISNFLLEKSRVVMQNEDERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSD
TYKVDGTDDQRDFNETLSAMQVIGIPPSIQQLVLQLVAGILHLGNISFCEEGNYARVEST
DLLAFPAYLLGINSGRLQEKLTSRKMDSRWGGRSESIDVTLNVEQAAYTRDALAKGLYAR
LFDFLAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAE
QEEYVQEGIRWTPIEYFNNKVVCDLIENKLTLLQKLQAAVGTHEHFNSWSSGFVIHHYAG
KVSYDISGFCERNRDVLFSDLIELMQTSEQAFLRMLFPEKLDMDKKGRPSTAGSKIKKQA
NDLVATLKRCTPHYIRCIKPNETKRPRDWEESRVKHQVEYLGLRENIRVRRAGFAYRRQF
SKFLQRYAILTPETWPRWRRDERQGVQHLLRAVNMDPDQYQMGATKVFVKNPESLFLLEE
MRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLE
ERPELRQFLGKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGQVR
EILKKKLELQTLRGVSLSTRQDDFFILQEAAADSFLESIFKTEFVSLLCKRFEEAAQRPL
PLNFSDTLQFRVKKEGWGGGGTRSVTFARGSGDLAVLKAGGRGLTVSVGDGLPKSSKPTR
KGMAQGRHRRPAQAPTRAAPGPPRALDRNGVPPLARGGPLALDITPGRNSQQPPRGPPAS
TLGARRRSRAHPPSEHNTEFLNVPDQGVAGMQRKRSIGQRPVPGVGRPKPQPRVHGPRCR
ALYQYIGQDVDELSFNINEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI
Download sequence
Identical sequences G5B4L3
HGL_H00000304899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]