SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000305071 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000305071
Domain Number 1 Region: 92-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-36
Family Ankyrin repeat 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000305071
Sequence length 259
Comment RFXANK (Homo_sapiens) regulatory factor X-associated ankyrin-containing protein
Sequence
MEPTRPAEDLLSSQPPPDPELRDPEDPGSEAPDGSDTVVLSLFACAAEPGNPEADASASS
LQGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKEHLRKGDNLVNKPD
DHGFTPLIWASAFGEIQTVRFLLDWGADPHILAKERESALSLASMGGYTDIVGLLLEHDV
DINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQV
MENHILKLFQSSLGPVGPE
Download sequence
Identical sequences G5C5C3
HGL_H00000305071 XP_004873479.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]