SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000305556-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000305556-1
Domain Number 1 Region: 276-348
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.45e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000185
Further Details:      
 
Domain Number 2 Region: 94-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.89e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 7-83
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000305556-1
Sequence length 355
Comment PCBP1 (Homo_sapiens) poly(rC) binding protein 1
Sequence
MDAGVTEGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITL
TGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIK
EIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTI
PYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQV
ARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGAN
INEIRQMSGAQIKIANPVEGSSGRQITITGSAASISLAQYLINARLSSEKGMGCS
Download sequence
Identical sequences G5C2H1
HGL_H00000305556-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]