SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000305696-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000305696-2
Domain Number - Region: 66-136
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 0.00719
Family Ribosome-binding factor A, RbfA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000305696-2
Sequence length 242
Comment C18orf22 (Homo_sapiens) Putative ribosome-binding factor A, mitochondrial Precursor
Sequence
MNGRTRGLRGSAGSYGKKNLLKKLASKSRKKFWYEGPSLGSRLTYKPSKLESLLKATSKK
TRKEDHVWQRALNGLLCKALTDLLSTPEGSQEVYDLNVKLSKAPFDVQQTLKNVPPIVFM
QDRRNALLAEVDRLLEIADDLPCTLSYLCGIDHEALNKQIMEYKQKNEKGLRDMDLVPPG
QEPMAKLPQWVRRRKKAPLQKDQDTSPRSFLLDEDQDSTLGCGCESQRAEEWKAEPGGGG
TQ
Download sequence
Identical sequences G5BWG0
HGL_H00000305696-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]