SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000305699 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000305699
Domain Number 1 Region: 11-164
Classification Level Classification E-value
Superfamily Hook domain 8.37e-58
Family Hook domain 0.00000107
Further Details:      
 
Weak hits

Sequence:  HGL_H00000305699
Domain Number - Region: 488-658
Classification Level Classification E-value
Superfamily Tropomyosin 0.0183
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number - Region: 248-329
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number - Region: 311-412
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000305699
Sequence length 718
Comment HOOK3 (Homo_sapiens) hook homolog 3 (Drosophila)
Sequence
MFNVESVERMELCESLLTWIQTFNVDTPCQTVEDLTNGVVMAQILQKIDPTYFDENWLNR
IKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQ
LILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSKESPVSSGNDAYVDLDRQLKK
TTEELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQILMERLNQSDSIEDPNSPA
GRRHLQLQTQLEQLQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLK
DEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRK
ANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLKEKVDSLQKEKDRLRTERDSL
KETIEELRCVQAQEGQLTTQGFMPLGSQESSDSLAAEIVTPEIREKLIRLQHENKMLKIN
QEGSDNEKIALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAEN
SVLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQM
EERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQEQDRLFHSLEKEYEKTKSQRDM
EEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSTRRSYPAHVQPATAR
Download sequence
Identical sequences G5BUV4
HGL_H00000305699 XP_004855316.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]