SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000305721 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000305721
Domain Number 1 Region: 131-364
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.22e-52
Family Regulator of chromosome condensation RCC1 0.0062
Further Details:      
 
Domain Number 2 Region: 764-869
Classification Level Classification E-value
Superfamily POZ domain 1.26e-20
Family BTB/POZ domain 0.0096
Further Details:      
 
Domain Number 3 Region: 26-127
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.86e-18
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 539-642
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000175
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000305721
Sequence length 1324
Comment IBTK (Homo_sapiens) inhibitor of Bruton agammaglobulinemia tyrosine kinase
Sequence
MSSIPDCTSKCRSLKHALDVLSVVTKGSENQIKAFLSSHCYNAATIKDAFGRKALHLVSS
CGKKAVLDWLIEKGVDPLVKDKESGWTALHRSIFYGHIDCVWSLLKHGVSLYMQDKEGLS
ALDLLMKDRPTHVVFKSTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGVYIKQ
VVLCKFHSVFLSQKGQVYTCGHGPGGRLGHGDEQTCLVPRLVEGLNGHNCSQVAAAKDHT
VVLTEDGCVYTFGLNIFHQLGIIPPPSSCNVPRQMQAKYLKGRTVIGVAAGRFHTVLWTR
EAVYTMGLNGGQLGYLLDPNGEKCVTAPRQVSALHHKDINLSLVAASDGSTVCVTTRGDI
YLLADYQCKKMASKQLNLKKVLVSGGRMEYKVDPEHLKENGGQKLCILAMDGAGRVFCWR
SVSSSLKQCRWAYPRQVFISDIGLSRNEILFVTKDGEGFRGKWFEEKRKNSEKKADILSN
LHNSSSDMSCVSDTNNVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPT
VSSSSFFEEFGKLLRETDEMDNIHDVTFQVGNRIFPAHKYILAVHAEFFQKLFLSDGTTL
EFPDVYRKDEDSAGCHLFVVEKVHPDLFEYLLQFIYTDTCDFLTHGFKPRIHLRRKPEEY
QDTLNSQMNKMNCYEDDSQKSAFEVYKSNQTHSVSERQKSKPKSLKKGKSIGEDDPVRML
QNVAKKFGLSNLSSRLDGVRFENEEINVIARKTGNKLKLSQKKCSFLCDVTMKSVDGKEF
PCHKCVLCARLEYFNSMLSSSWIEASSCAALEMPIHSDILKVILDYLYTDEAVVIKESQN
VDFICSVLVVADQLLITRLKEICEVALTEKLTLKNAAMLLEFAAMYNAEQLKLSCLQFIG
LNMAALLEARSLDVLSDDVLKDLSVFYRKMIPAMDRRVITPYQDGPDISYLDTEDSDVFL
KEELNMEQNYSETMFKKAKTKAKKKPRKRSDSSGGYNLSDIIQSPPSTGLLKSGKTNSVE
SLPELLTSDSEGSYAGAGSPRDLQSPDFSTGFHSDKMEPYVNGTPTTYSKEDLKQWEKSP
ILKVSAPQPIPSNRIDMTSSSTWVTGSFSPVSPPVVDLRTIMEIEENRQKCGATRKSNSG
KMIPHGVKLSQKQRKMIALTTKEHSSGTSSMETVLNASSKAPKSVNAWTSALHSFSCKSF
WDFSIEDKKYVINHSSGDHVKKTCFKWIENSQTPKVVSPWLSSSLTAPVVAPVTFASIVE
EEQKQEAALIRSREKPLALIQIEEHAIQDLLVFYEAFGNPDEFVIVERTSQGPLAVPMWN
KHGC
Download sequence
Identical sequences G5BYI1
HGL_H00000305721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]