SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000306163 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000306163
Domain Number 1 Region: 125-293
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.15e-50
Family Ankyrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000306163
Sequence length 332
Comment ANKRD2 (Homo_sapiens) ankyrin repeat domain 2 (stretch responsive muscle)
Sequence
MEGTVEGSEAVQRATALIEQRLAEEEENEKLQGTSHRKLPMEMLVLEDEKHLGAQSQALQ
KVKSQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQRKREALAAAQEPPPELEEISGPV
DKEMFLKAAVEGKMKVIEKFLADGGSADTCDEFHRTALHRASLEGHMEILEKLLGNGATV
DFQDRLDCTAMHWACRGGHLEVVKLLQSRGADTNVRDKLLSTPLHVAVRTGHVEIVEHFL
SLGVDINVRDREGDSALHDAVRLNRYKIIKLLLLHGADMMAKNLAGKTPTDLVQLWQADT
RHALEHPEPATEQNGLEGSESGRETPQQVPAQ
Download sequence
Identical sequences G5C0C0
XP_004838657.1.39548 HGL_H00000306163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]