SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000306351-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000306351-1
Domain Number 1 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 512-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000137
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Weak hits

Sequence:  HGL_H00000306351-1
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0034
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000306351-1
Sequence length 582
Comment ZNF182 (Homo_sapiens) zinc finger protein 182
Sequence
MLETYSHLVSLGQQVTKPDLILKLEVEEPCPAEGKVPIWSFSEVCQIDEQIDKQHQDDRD
KCLLMQVGFPGKKIITTKSGCECNGFGNTLHLSTRFVVPIQRPHKLRSFGSNMVDNCDLF
RSSAEKKHNNGCAKLFFHTEYEKNLVVKPYGYKECGKALRPKKGLSLHQRIKNGEKPFEC
TACQKTFSKKSHLTVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERPFECPECG
KAFREKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTKCGESFM
QKLDLIIHHSTHTGKKPHECSECKKTFSDKSTLTVHQRTHTGEKPHKCTVCGKSFNEKST
LIVHQRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLH
QRGHTGEKPYECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIH
TGEKPYECLVCWKAFSQKSQLIIHQRTHTGEKPYACTVCGKAFREKSTFTVHQRTHTGEK
PYNCTECGKAFTQRSNLIVHQRTHTGKAHGRGHTWKSKLTGH
Download sequence
Identical sequences G5AXP2
HGL_H00000306351-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]