SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000306565 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000306565
Domain Number 1 Region: 7-173
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.59e-35
Family DnaQ-like 3'-5' exonuclease 0.000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000306565
Sequence length 181
Comment ISG20 (Homo_sapiens) interferon stimulated exonuclease gene 20kDa
Sequence
MAGSLEVVAMDCEMVGLGPLRESGLARCSLVSLSGSVLYDKFIRPEGVITDYRTRVSGVT
RLHMEAATPFAEARREILQLLKGRLVVGHDLKHDFKALKEDMNGYTIYDTSTDWVLWREA
NLEHCNRVSLRVLCERLLHKRIQNNLLGHSSVEDAKATMELYRLSQRIRARQGLPCLAGS
D
Download sequence
Identical sequences G5CA83
HGL_H00000306565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]