SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000306678 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000306678
Domain Number 1 Region: 308-687
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.03e-102
Family Ankyrin repeat 0.000000897
Further Details:      
 
Domain Number 2 Region: 7-230
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-58
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000306678
Sequence length 708
Comment ANKK1 (Homo_sapiens) ankyrin repeat and kinase domain containing 1
Sequence
MCPCSDVNCLIEEATKMEKIKFQHIVPIYGVCKQPLGIVMEFMANGSLEKMLPTHSLSWQ
LKFRIIHETSLAMNFLHSIKPPLLHLDLKPGNILLDNNIHVKISDFGLSKWMEESTRMQY
IERSALRGTLSYIPPEMFLQSNKAPGPKYDVYSFGIVIWELLTQKKPYTGLNMMTIIIRV
AAGMRPSLHPVSDEWPGEAQQMVDLMRRCWDQDPKKRPCFLDITVETDMLLSLLQCPVAD
PEIEALARKVSCKPSLRHRAQQVSEEAGQELTDSDSGDYLKQVLQPSDSESFVPSDEELR
VYENKVMPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLTH
GADANLVDEDDWAPLHFAAQNGDDRTARLLLDHGALVDAQEHEGWTPLHLATQNNFENVA
RLLVSRHADPNLREAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVER
GKVRAIQYLLKSGAAPDALDQSGYSPLHIAAACSKYLICKMLLRYGASLELPTQQGWTPL
HLATYKGHLEIIHLLAESHADMGALGSMNWTPLHLAAHHGEETVLLALLQCGAHPNAAEQ
SGWTPLHLAVQRGAFLSVINLLEHGADVHACNKVGWTPAHLAALKGNTAILKVLIRAGAQ
LDIQDEVGCTPLQLALRSQKQSIVAFLEGKEPSLAILGSVEPGAQMQV
Download sequence
Identical sequences G5BEX4
HGL_H00000306678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]