SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307156 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307156
Domain Number 1 Region: 350-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 2 Region: 786-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 3 Region: 941-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000026
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 4 Region: 880-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 5 Region: 525-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 6 Region: 989-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.0042
Further Details:      
 
Domain Number 7 Region: 834-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 8 Region: 286-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 9 Region: 473-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 10 Region: 435-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1041-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 12 Region: 1098-1141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.047
Further Details:      
 
Domain Number 13 Region: 1146-1193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000307156
Domain Number - Region: 1576-1772
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307156
Sequence length 1789
Comment LAMB2 (Homo_sapiens) laminin, beta 2 (laminin S)
Sequence
MEWASEDRGRCRQGQPVPWDLRLGLLLSVLATTLAQAPSLDMPGCSRGSCYPATGDLLVG
RADRLTASSTCGLRGPQPYCIVSHLQDEKKCFLCDSRHPFSAPNNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWYVYRY
FSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQ
NLLKITNLRVNLTRLHTLGDHLLDPRREIREKYYYALYELVVRGNCFCYGHASQCVPAPG
APAHAEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWHPAEDGYSHACRKCECHGHTHSCH
FDMAIYLASGNVSGGVCDRCQHNTVGHHCELCRPFFYRDPTKDLRDPAVCHPCDCDPMGS
QDGGLCDSHDDAALGLVSGQCRCKEHVMGPSCQRCRDGFFGLSASDPLGCQRCQCNARGT
VSGGTPCDANSGICFCKRLVTGHGCDHCLPGHWGLSHDLLGCRPCDCDVGGALDAQCDEA
TGQCHCRPHMVGRRCEKVQPGYFRPFLDHLTWEAEDARGQVLDVVERLAATGEAPSWTGP
GFVQLREGQTLEFLVISLPKAMDYDLLLRLEPQVPEQWAEIELTVQRPSSVAAHTPCGHV
VPNDDRIQGTLQADIRYMVLPKPVCLEPGISYRLHLKLVRTGGRAQPQVPYSGPGLLIDS
LVLLPRVLALEMFSAGDVTSLERRATFEHYRCHEEGLMPSKTPPTEACDPLLISLSTLIY
NGALPCQCDPEGSLSSECNPHGGQCLCKPGVVGRRCNICAIGYYGFGPTGCQACQCSSEG
ALSGLCEGTTGQCPCRPGAFGLRCDRCQHGQWGFPNCWPCVCNGHTDECDAHTGTCLSCR
DHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRNFAASCHRDGYSQQIVCHCQ
LGYTGLRCDTCAPGHFGDPSRPGGRCQPCECSGNIDPTDPDACNSHTGQCIRCLHHTEGP
HCAHCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSTDQCRCDPSSGQCPCLPNVQGLSCD
HCAPNFWNLTSGHGCQPCACHLTRARSPTCNEFTGECHCHAGFGGRTCSECQELHWGDPG
LQCRACDCDPRGVDTPQCHHSTGHCRCRPGVSGVRCDQCARGFSGVFPACHSCHACFGDW
DRIVQDLAARTTRVLGSFESSFWHIQEKLGKVQAIVGARNTSAASTAQLVEAIEDLRREI
GQATERLTQLEAELTDVQDENFNANHALSSLERDGLALNLTLRQLGQHLDLLKHSNFLGA
YDSIRHAHSQSAEAERHANTSVLSIPSPVSNSADTRHRTEVLIDAQMEDFRQMHLANQWA
LSELSVHTRTLSLTGINELVCGAPGDEPCATSPCGGAGCRDEDGQPRCGGLSCSGAAATA
DLALTRARHTQAELQRTLVEGGGILSRVAETRRQAGEAQQWAQATLEKANASRGQVEQAN
QELRELIQSVKDFLSQEGADPDSIEMVAMRVLELSIPASPEQIQHLAGEIAKRVRSLADV
DTILARTIGDVLRAEQLLQDAQRARSWAEGEKQKAETVQEALEEALRAQGIAQGAIQGAV
VDTHNTEQTMHQVQERMTGAEQSLSSVGERAQQLDALLEALKLKRAGNSLAVSTAEETAG
IAHTRAQEAEQLLQGPVGDQYQTVKALAERKAQGVLAAQVRAEQLRDEARGLLQAAQDKL
QRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences G5BZV5
HGL_H00000307156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]