SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307235 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307235
Domain Number 1 Region: 494-572,787-984
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-60
Family Protein kinases, catalytic subunit 0.00048
Further Details:      
 
Domain Number 2 Region: 13-176,206-263
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.63e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307235
Sequence length 1017
Comment EIF2AK3 (Homo_sapiens) eukaryotic translation initiation factor 2-alpha kinase 3
Sequence
MSRGCLENGVQRSLVIISTLDGRIAALDAENHGKKQWDLDVGSGSLVSSSLSKPEVFGNK
MIIPSLDGDLFQWDRDRESMETVPFTVESLLESSYKFGDDVVLVGGKSLTTYGLSAYNGK
VRYICSALGCRRWDSDEMEEEEDILLLQRTQKTVRAVGPRSGTEKWNFSVGHFELRYIPD
METRAGFIESTFKPSENKEESKIISDVEEQEATMLDTVIKVSVADWKVMAFSKKGGHLEW
EYQFCTPIASAWLLRDGKVIPISLFDDTSYGSNEEVLEDEEDIVEAARGATENSVYLGMY
RGQLYLQSSVRISEKFPTSPKALESSENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKC
LSNDKFSHEEYSNGALSILQYPYDNGYYLPYYKRERNKRSTQITVRFFDNPNYKSIRKKD
PVLLLHWWKEIVGTILFCIIATTFIVRRLFHPQPHRQRKESETQCQTENKYDSVRGEASD
SSWNDIKSSGYVSRYLTDFEPIQCMGRGGFGVVFEARNKVDDCNYAIKRIRLPNRELARE
KVMREVKALAKLEHPGIVRYFNAWLEAPPEKWQEKMDEIWLKDESTDWPLSSLSPMDAPS
VKIRRVDPFSTKEHIEIIAPSPQRSRSFSVGISRGQTSSSESQFSPLELSGTDHGDSSGS
ADAANNLQDSCLTDCDMEDGTMDANDEGYSFELCPSEASPYVRSRETSSSIVFEDSGCDN
ASSKEEPKTNRVHIGNHCANKLTALKYSSSRSSEATLSVSPPRPTTLSLDLTKNTTEKLQ
PSSPKVYLYIQMQLCRKENLKDWMNQRCTLEERERGVCLHIFLQIAEAVEFLHSKGLMHR
DLKPSNIFFTVDDVVKVGDFGLVTAMDQDEEEQTVLTPMPATHTGQVGTKLYMSPEQARN
NYSHKVDIFSLGLILFELLYPFSTQMERVRTLTDVRNLKFPPLFTQKYPREYVMVQDMLS
PSPVDRPEATNIIENALFEDLELPGKAVLRQRSRSLSSSGAKHSRLPSTSGSPAPSS
Download sequence
Identical sequences G5AQX0
HGL_H00000307235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]