SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307272 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307272
Domain Number 1 Region: 390-671,798-846
Classification Level Classification E-value
Superfamily ARM repeat 1.63e-46
Family PBS lyase HEAT-like repeat 0.023
Further Details:      
 
Domain Number 2 Region: 1017-1330
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.66e-40
Family WD40-repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307272
Sequence length 1334
Comment RPTOR (Homo_sapiens) regulatory associated protein of MTOR, complex 1
Sequence
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEATINPNHPLAQMPLPPSMKNCI
QLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGR
LNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYN
CTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLT
MGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQ
SSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAV
IVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAH
EKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVRK
ELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPKLRSVS
SYGNIRAVTTARSLNKSLQNLSLTEEAGGAVAFSPGNLSTSSSASSTLGSPENEEHILSF
ETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKA
TVNARPQRILDTSSLTQSAPASPTNKGMHIHQVGGSPPASSTSSCSLTNDVAKQPVSRDL
PPGRPGPTGPTGAQYTPHSHQFPRTRKMFDKGPDQTADDADDAAGHKSFICAAMQTGFCD
WSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRRQAQQVVQKGITRLDDQIFLNR
NPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDC
SLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSS
GDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSE
CRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVLQIVKGLTALDI
HPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSN
DYYISVYSVEKRAR
Download sequence
Identical sequences G5BJ54
HGL_H00000307272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]