SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307541 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307541
Domain Number 1 Region: 1445-1509,1577-1624
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-25
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307541
Sequence length 1803
Comment BCORL1 (Homo_sapiens) BCL6 corepressor-like 1
Sequence
MISTAPLYSGVHNWTSSDRIRMCGINEERLTAIRYHWEASEEDETAERSFDTELRVGDAC
LICVFSGFVHQNIWLTKGNVLYILDSHLDERAPLSDEESTTGDCQHFGSQEFCVGSSFSK
VELTAVGSGSNARGADPDGSSTEKLGHKSEDQPDDPQPKMDYAGNAAEAEGLLVPLSSPG
DGLKLPTPDCPEASNSRAECSWTPLSTQMSKQHQFQLWLRHLPQCPPSSRIRTPFPCQPR
SWCLCQHPLPHRAQYPCRLPLLPLSLSPLQHLPWLSSRLPCLLQRPPCSLLPSPLRSWLP
CRHRHLQQLLPLRLCRSAPTPAPIFTPAPTPMPAATPTAVPTSAPIPASFSLSRVCFPAA
QAPAMQKVPLSFQPGTVLTPSQPLVYIPPPSCGQPLSVATLPTTLGVSSTLTLPVLPSYL
QDRCLPGVLASPELRSYPYAFSVARPLTSDSKLVSLEVNRLPCTSPSSSTTTQPAPEGVP
GPLADTSLTTASAKVLPTPQPLLPAPSGSSAPPHPTKMPGGGEQQTEGASVTFSPLKSPP
QLEREMASPPECSEMPLDLSSKSNRQKLPLPNQRKTPPMPVLTPVHTSSKALLSTVLSRS
QRTTQAAGSNVTSCLGSTSSPFVIFPEIVRNGDPSTWVKNSTALISTIPGTYVGVANPVP
ASLLLNKDPNLGLNRDPRHLPKQEPISIIDQGEPKSTGATCGKKGSQSGAEGQPSTVKTR
YTPARIAPGLPGCQSKELSLWKPTGPANIYPRCSVNGKPTSTQVLPVGWSPYHQTSLLSI
GISSAGQLTPSQGVPIRPTSVVSEFSGVPSVGSSEAVHGLTEGQPRSGGPFTSEQDTVTK
NKTCRIAAKPYEEQVNPVLLTLSPQTGTLALSVQPSSGDIRVNQGSEESESHLCSDSTPK
MEGSQAACSLKLAGDTKPKNQVLATYMSHELVLATPQNLRKVPELPLLPHDSHPQELILD
VVPSSKRGSSTELSQLGSQVDLGRVKMEKVDGDVVFNLATCFRADGLPAAPQRGQAEARA
KTMQAQVKRESVGVFACKSKWQPDEVPESPPPKKMKCGKEKEGEEQQQLPQAKPTVQSSL
GSKCRKPPGDPQEPTKKSPRGTSDSGKEHNGVRGKHKHRKPTKPESQSPGKRADGHEEDA
GCDISAFCPETMHTGSLEKKAKSSFRDFIPVVLSTRTRSQSGSICSSFAGVADSDMGSQE
VFPTEEEEEVTPTPAKRRKVRKTQRDTQYRSHHAQDKTLLSQGRRHLWRAREMPWRTEAA
RQMWDTNEEEEEDEEEGLVKRKKRRRQKSRKYQTGEYLTEQEEEQRRKGRADLKARKQKT
SSQSSEHRLRNRNLLLPSKAQGISESPNGFLPNNLEEPACLENPEKPSGKRKCKTKHMSN
VSEEAKGKGRWSQQKTRSSKSPTPAKFTEPCTPSKSRSAGPEEASESPTARQIPPEARRL
IVNKNAGETLLQRAARLGYKDVVLYCLQKDSEDVNHRDNAGYTALHEACSRGWTDILNIL
LQHGANVNCSAQDGTRQAPQHPAQPLTENNLPQPQPLQHTKLRAAGRPVLYTVERTYFLG
RIDMSYVPSRRTQTKRPGYTWQLVPVHDAVVNDNLETIWLLLSYGADPTLATYSGQTALK
LASSDAMKRFLSDHLSDLQGRAEGDPGVSWDFYSSSVLEQKDGFTCDLLHNPPGSADQEG
DDVEEDDFMFELSDKPLLPCYNLQVSVSRGPCNWFLFTDVLKRLKLSSRIFQARFPHFEI
PTLPKAEFYRQVASSQLLTPAERPGGVEDRSPPGSSETVELVAYGPELLRLLGSEVEFQS
WNS
Download sequence
Identical sequences G5B2Q6
HGL_H00000307541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]